PeptideFinder The term "peptide 2" can refer to several distinct entities within the scientific and commercial realms, ranging from specific biological molecules like Glucagon-Like Peptide-2 (GLP-2) to specialized laboratory equipment and even commercial product lines.Glucagon-Like Peptide 2: A Nutrient-Responsive Gut ... Understanding the context is crucial, as each usage implies a different set of characteristics, applications, and potential research or commercial interests. The diverse search results highlight this ambiguity, touching upon areas from gastrointestinal health and antimicrobial defense to peptide synthesis technology and growth hormone regulation.
Glucagon-Like Peptide-2 (GLP-2) is a significant hormone with well-documented physiological functions, particularly within the gastrointestinal tractMultipep 2 - Automated Parallel Peptide Synthesizer. As a 33-amino acid peptide derived from proglucagon, GLP-2 is secreted by enteroendocrine L cells in the intestinal epithelium. Its primary role is to promote gut health by stimulating cell proliferation and inhibiting apoptosis in both the small and large intestines, acting as a potent intestinotrophic factor. This makes GLP-2 a subject of considerable research interest for conditions affecting gut integrity and function, such as inflammatory bowel diseases and malabsorption syndromes.
The therapeutic potential of GLP-2 is actively being explored. Its ability to enhance intestinal barrier function, increase villus height, and reduce intestinal permeability positions it as a promising agent for managing gastrointestinal disordersLiver-Expressed Antimicrobial Peptide-2 (LEAP-2). Research into GLP-2 and its analogs aims to harness these properties for clinical applications, driving demand for high-purity GLP-2 for both experimental and potential therapeutic use.
Beyond GLP-2, the term "peptide 2" can also denote other specific peptides with unique biological activities. For instance, Liver-Expressed Antimicrobial Peptide-2 (LEAP-2) is recognized for its vital role in the innate immune system of vertebrates, contributing to host defense against pathogens. Similarly, Growth Hormone Releasing Peptide-2 (GHRP-2) is a synthetic peptide that acts as an agonist of ghrelin, stimulating the release of growth hormone, and finds applications in research and potentially in therapeutic contexts related to growth and metabolism. Anti-Inflammatory Peptide 2 is another example, a synthetic peptide designed for its potent anti-inflammatory properties.
The "peptide 2" query also frequently intersects with the field of peptide synthesis. This includes sophisticated laboratory equipment designed for the efficient creation of peptides. Automated parallel peptide synthesizers, such as the MultiPep 2, are state-of-the-art instruments capable of synthesizing hundreds of peptides simultaneously, accelerating research and drug discovery efforts. Companies specializing in custom peptide synthesis offer services for researchers requiring specific peptide sequences, emphasizing factors like synthesis price, purity, and delivery timesGlucagon-like Peptide-2 (GLP-2), human / Preproglucagon ....
Given the multiple meanings of "peptide 2," clarity is paramountGrowth Hormone Releasing Peptide-2 Syntheticis a single, non-glycosylated polypeptide chain containing 6 amino acids, having a molecular mass of 817.9 Dalton.. When encountering this term, it is essential to consider the context. In a biological or medical context, it most commonly refers to Glucagon-Like Peptide-2 (GLP-2) or other specific biologically active peptides like LEAP-2 or GHRP-2. In a laboratory or manufacturing setting, it may refer to a specific model of peptide synthesizer or a commercial product line. Resources like UniProt, a comprehensive protein sequence and functional information database, are invaluable for identifying and characterizing specific peptides by their sequence and known functions, helping to differentiate between the various entities that "peptide 2" might representGrowth hormone releasing peptide-2 (GHRP-2) (for injectable and nasal routes of administration), 503B, September 29, 2023, Compounded drugs containing GHRP-2 ....
The term "peptide 2" is a multifaceted descriptor that encompasses specific hormones like Glucagon-Like Peptide-2 (GLP-2) with critical roles in gastrointestinal health, other biologically active peptides such as LEAP-2 and GHRP-2, and advanced laboratory equipment for peptide synthesis. Understanding the distinct applications and scientific significance of each entity is crucial for researchers, clinicians, and industry professionals.Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see Proteinogenic amino acid) in humans. Whether investigating gut physiology, exploring antimicrobial defenses, or advancing drug discovery through peptide synthesis, the specific nature of "peptide 2" must be clearly defined to ensure accurate interpretation and effective utilization of information and resources.
Join the newsletter to receive news, updates, new products and freebies in your inbox.